PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g034360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family G2-like
Protein Properties Length: 356aa    MW: 39597.3 Da    PI: 6.8478
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g034360.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32216271156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  Csa07g034360.1 216 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 271
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.61E-17213274IPR009057Homeodomain-like
PROSITE profilePS5129414.821213273IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-28214274IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-27216271IPR006447Myb domain, plants
PfamPF002495.6E-8218269IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MMVEMDYAKK MQKCHEYVEA LEQEQKKIQV FQRELPFCLE LVTQAIEACR KELSGTTISE  60
QQCSEQTTSV CGGPVFEEFI PIKKRSLSQE DEEDEEEDEH ESSPELEQTN KKSDWLRSVQ  120
LWNPSPDLNP KEERVVKRAK VVEVKPKSGA FQPFQKEKKR VLETDLQPAA VKVASSAPAT  180
TTSSTTETGG AKSDLDKVGE EQIQMTQQHQ TQTHRKQRRC WSPELHRRFL NALQQLGGSH  240
VATPKQIRDH MKVDGLTNDE VKSHLQKYRL HTRRPATTVA AQSNGNPQQP QFVVVGGIWV  300
PSPQDFHPPS DAANNGGGVY APVAVAAQSP KRSVERSCNS PGASSSTNTA TTPVS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010415495.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLR0IF320.0R0IF32_9BRAS; Uncharacterized protein
STRINGAT1G68670.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-139G2-like family protein